PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0988s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 189aa    MW: 20453.2 Da    PI: 7.641
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0988s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like605e-19132180251
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                          p+l Wt++LH++F+ a++   G ekA Pk+i e+++v gLt+++v+SHLQ
  Kalax.0988s0002.1.p 132 PKLIWTTQLHNKFLCALHIV-GLEKAQPKKIHEVVNVAGLTRANVASHLQ 180
                          89****************99.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.2E-5141No hitNo description
PROSITE profilePS5011012.299139IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:1.10.10.606.8E-18130180IPR009057Homeodomain-like
SuperFamilySSF466898.78E-13130182IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-17131181IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSADDKTDTV LRGLNGGAVL YMHKPVSTAE LKNIWQFIYH YSGKAIMNEH TENFSEDVGG  60
SSCGSSTPGD PHFIAVSGAT TQFWKGNSNA AEDPLKIYNT RCVQHADGMQ IGEATLNNNA  120
PLPVVPRTGN NPKLIWTTQL HNKFLCALHI VGLEKAQPKK IHEVVNVAGL TRANVASHLQ  180
VMCPYTIV*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-23response regulator 2